DUS1L Antibody - middle region : Biotin

DUS1L Antibody - middle region : Biotin
Artikelnummer
AVIARP57615_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DUS1L

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like

Protein Size: 473

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57615_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57615_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64118
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×