E2f5 Antibody - C-terminal region : Biotin

E2f5 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP57966_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: E2f5 is a transcriptional activator that binds to E2F sites, these sites are present in the promoter of many genes whose products are involved in cell proliferation. It may mediate growth factor-initiated signal transduction.

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: QPSSQSSTSVTPQKSTMAAQNLPEQHVSERSQTFQQTPAAEVSSGSISGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription factor E2F5

Protein Size: 335

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57966_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57966_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 13559
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×