E2f5 Antibody - C-terminal region : HRP

E2f5 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57966_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: E2f5 is a transcriptional activator that binds to E2F sites, these sites are present in the promoter of many genes whose products are involved in cell proliferation. It may mediate growth factor-initiated signal transduction.

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: QPSSQSSTSVTPQKSTMAAQNLPEQHVSERSQTFQQTPAAEVSSGSISGD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription factor E2F5

Protein Size: 335

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57966_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57966_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 13559
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×