EDDM3B Antibody - middle region : Biotin

EDDM3B Antibody - middle region : Biotin
Artikelnummer
AVIARP53756_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existing components and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes are synthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come into contact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster are synthesized and secreted by epididymal epithelial cells.

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: ISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epididymal secretory protein E3-beta

Protein Size: 147

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53756_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53756_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64184
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×