EDDM3B Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existing components and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes are synthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come into contact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster are synthesized and secreted by epididymal epithelial cells.

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: ISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Epididymal secretory protein E3-beta

Protein Size: 147

Purification: Affinity Purified

• Artikelnummer: AVIARP53756_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53756_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 64184
• Wirt: Rabbit
• Konjugat: Conjugated, HRP