EEA1 Antibody - middle region : FITC

EEA1 Antibody - middle region : FITC
Artikelnummer
AVIARP58125_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: EEA1 is involved in neuronal synaptic vesicle function and axonal transport and growth. EEA1 may undergo calcium-dependent conformational changes that are required for binding to SNAP-25.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EEA1

Key Reference: Selak,S., (2006) Neuroscience 143 (4), 953-964

Molecular Weight: 162kDa

Peptide Sequence: Synthetic peptide located within the following region: QEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Early endosome antigen 1

Protein Size: 1411

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58125_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58125_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 8411
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×