EFHA2 Antibody - N-terminal region : FITC

EFHA2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55801_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EFHA2

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: TLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: EF-hand domain-containing family member A2

Protein Size: 530

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55801_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55801_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 286097
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×