EFHC1 Antibody - N-terminal region : Biotin

EFHC1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP53729_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes an EF-hand-containing calcium binding protein. The encoded protein likely plays a role in calcium homeostasis. Mutations in this gene have been associated with susceptibility to juvenile myoclonic epilepsy and juvenile absence epilepsy. Alternatively spliced transcript variants have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human EFHC1

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: DTVEIREVHERNDGRDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: EF-hand domain-containing protein 1

Protein Size: 550

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53729_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53729_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 114327
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×