EHD4 Antibody - middle region : Biotin

EHD4 Antibody - middle region : Biotin
Artikelnummer
AVIARP55432_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EHD4

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: EH domain-containing protein 4

Protein Size: 541

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55432_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55432_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 30844
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×