EIF2C1 Antibody - N-terminal region : Biotin

EIF2C1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54863_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-me

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2C1

Key Reference: Eulalio,A., (2008) Nat. Struct. Mol. Biol. 15 (4), 346-353

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein argonaute-1

Protein Size: 857

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54863_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54863_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26523
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×