EIF5 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: EIF5 catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF5

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: SVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eukaryotic translation initiation factor 5

Protein Size: 431

Purification: Affinity Purified

• Artikelnummer: AVIARP53443_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53443_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 1983
• Wirt: Rabbit
• Konjugat: Conjugated, FITC