EIF5A2 Antibody - N-terminal region : Biotin

EIF5A2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57402_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: EIF5A2 is a mRNA-binding protein involved in translation elongation. EIF5A2 has an important function at the level of mRNA turnover, probably acting downstream of decapping.EIF5A2 is involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. EIF5A2 functions as a regulator of apoptosis.EIF5A2 mediates effects of polyamines on neuronal process extension and survival.EIF5A2 may play an important role in brain development and function, and in skeletal muscle stem cell differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF5A2

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eukaryotic translation initiation factor 5A-2

Protein Size: 153

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57402_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57402_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56648
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×