ELMOD1 Antibody - middle region : Biotin

ELMOD1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57287_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of ELMOD1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ELMOD1

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: CYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ELMO domain-containing protein 1

Protein Size: 326

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57287_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57287_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55531
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×