ELMOD1 Antibody - N-terminal region : FITC

ELMOD1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57288_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ELMOD1 acts as a GTPase-activating protein (GAP) toward guanine nucleotide exchange factors like ARL2, ARL3, ARF1 and ARF6, but not for GTPases outside the Arf family.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ELMOD1

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: LKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ELMO domain-containing protein 1

Protein Size: 190

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57288_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57288_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55531
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×