ELMOD1 Antibody - N-terminal region : HRP

ELMOD1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57288_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ELMOD1 acts as a GTPase-activating protein (GAP) toward guanine nucleotide exchange factors like ARL2, ARL3, ARF1 and ARF6, but not for GTPases outside the Arf family.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ELMOD1

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: LKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ELMO domain-containing protein 1

Protein Size: 190

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57288_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57288_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55531
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×