EML3 Antibody - N-terminal region : Biotin

EML3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55579_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: EML3 may modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EML3

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: LLVRSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Echinoderm microtubule-associated protein-like 3

Protein Size: 896

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55579_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55579_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 256364
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×