EML3 Antibody - N-terminal region : HRP

EML3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55579_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: EML3 may modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EML3

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: LLVRSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Echinoderm microtubule-associated protein-like 3

Protein Size: 896

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55579_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55579_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 256364
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×