Enah Antibody - C-terminal region : Biotin

Enah Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP57152_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Enah

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: RRIAEKGSTIETEQKEDRNEDAEPITAKAPSTSTPEPTRKPWERTNTMNG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein enabled homolog Ensembl ENSMUSP00000106653

Protein Size: 785

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57152_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57152_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 13800
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×