ENOPH1 Antibody - N-terminal region : Biotin

ENOPH1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57529_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ENOPH1 is a bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENOPH1

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Enolase-phosphatase E1

Protein Size: 261

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57529_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57529_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 58478
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×