ENOSF1 Antibody - middle region : FITC

ENOSF1 Antibody - middle region : FITC
Artikelnummer
AVIARP56964_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene was originally identified as a naturally occurring antisense transcript to the human thymidylate synthase gene. Alternate splice variants have been described, one of which (named rTSalpha) represents an alternate 3'UTR that is complementary to the 3'UTR and terminal intron of the thymidylate synthase (TS) RNA and down-regulates TS expression. Other transcript variants (rTSbeta and rTSgamma) do not overlap the TS locus. The function of this gene appears to be primarily to regulate expression of the TS locus both via the antisense transcript as well as through the encoded proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ENOSF1

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: LMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGHATISKALVP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: mitochondrial enolase superfamily member 1

Protein Size: 367

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56964_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56964_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55556
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×