ENOSF1 Antibody - N-terminal region : HRP

ENOSF1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56963_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene was originally identified as a naturally occurring antisense transcript to the human thymidylate synthase gene. Alternate splice variants have been described, one of which (named rTSalpha) represents an alternate 3'UTR that is complementary to t

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENOSF1

Key Reference: Giusti,B., (er) Biochem. Genet. (2008) In press

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitochondrial enolase superfamily member 1

Protein Size: 443

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56963_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56963_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55556
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×