EP4 Receptor (C-Term) Blocking Peptide

Shelf life (days): 1095.0

Formulation: A lyophilized peptide

Formula Weight: 0.0

Notes: Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in conjunction with Cayman’s EP4 Receptor Polyclonal Antibody (Item No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.

• Artikelnummer: CAY301775-1
• Hersteller: Cayman Chemical
• Hersteller Artikelnummer: 301775-1
• Verpackungseinheit: 1 Piece
• Mengeneinheit: STK
• Methode: Immunofluorescence, Western Blotting, Immunohistochemistry
• Konjugat: Unconjugated