EPC2 Antibody - C-terminal region : FITC

EPC2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP55311_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: EPC2 may play a role in transcription or DNA repair.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPC2

Key Reference: N/A

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: TSKNGISVTGGITEEQFQTHQQQLVQMQRQQLAQLQQKQQSQHSSQQTHP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Enhancer of polycomb homolog 2

Protein Size: 807

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP55311_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55311_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26122
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×