EPC2 Antibody - C-terminal region : HRP

EPC2 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP55311_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: EPC2 may play a role in transcription or DNA repair.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPC2

Key Reference: N/A

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: TSKNGISVTGGITEEQFQTHQQQLVQMQRQQLAQLQQKQQSQHSSQQTHP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Enhancer of polycomb homolog 2

Protein Size: 807

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP55311_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55311_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26122
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×