EPHX1 Antibody - N-terminal region : Biotin

EPHX1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54285_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EPHX1

Molecular Weight: 53

Peptide Sequence: Synthetic peptide located within the following region: GPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epoxide hydrolase 1

Protein Size: 455

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54285_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54285_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2052
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×