EPS8 Antibody - middle region : Biotin

EPS8 Antibody - middle region : Biotin
Artikelnummer
AVIARP54726_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined. Highly similar proteins in other organisms are involved in the

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EPS8

Key Reference: Welsch,T., (2007) Cancer Lett. 255 (2), 205-218

Molecular Weight: 92kDa

Peptide Sequence: Synthetic peptide located within the following region: VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epidermal growth factor receptor kinase substrate 8

Protein Size: 822

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54726_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54726_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 2059
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×