Eras Antibody - N-terminal region : FITC

Eras Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55793_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Eras plays an important role in the tumor-like growth properties of embryonic stem cells.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTPase ERas

Protein Size: 227

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55793_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55793_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 353283
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×