ERCC1 Antibody - N-terminal region : FITC

ERCC1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55941_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved in recombinational DNA repair and in the repair of inter-strand crosslinks. Mutations in this gene result in cerebrooculofacioskeletal syndrome, and polymorphisms that alter expression of this gene may play a role in carcinogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. The last exon of this gene overlaps with the CD3e molecule, epsilon associated protein gene on the opposite strand.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ERCC1

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: TVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA excision repair protein ERCC-1

Protein Size: 213

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55941_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55941_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2067
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×