ERCC4 Antibody - middle region : HRP

ERCC4 Antibody - middle region : HRP
Artikelnummer
AVIARP58272_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1. Defects in this gene are a cause

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERCC4

Molecular Weight: 101kDa

Peptide Sequence: Synthetic peptide located within the following region: FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DNA repair endonuclease XPF

Protein Size: 916

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58272_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58272_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2072
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×