ERCC6L2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the Snf2 family of helicase-like proteins. The encoded protein may play a role in DNA repair and mitochondrial function. Mutations in this gene have been associated with bone marrow failure syndrome 2. Alternatively spliced transcript variants that encode different protein isoforms have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAD26L

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: ELWCVMDWAVPGLLGSGTYFKKQFSDPVEHGQRHTATKRELATGRKAMQR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA excision repair protein ERCC-6-like 2

Protein Size: 523

Purification: Affinity Purified

• Artikelnummer: AVIARP54401_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54401_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 375748
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin