ERCC6L2 Antibody - N-terminal region : FITC

ERCC6L2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54401_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the Snf2 family of helicase-like proteins. The encoded protein may play a role in DNA repair and mitochondrial function. Mutations in this gene have been associated with bone marrow failure syndrome 2. Alternatively spliced transcript variants that encode different protein isoforms have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAD26L

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: ELWCVMDWAVPGLLGSGTYFKKQFSDPVEHGQRHTATKRELATGRKAMQR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA excision repair protein ERCC-6-like 2

Protein Size: 523

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54401_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54401_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 375748
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×