ERG Antibody - N-terminal region : HRP

ERG Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57967_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: v-ets erythroblastosis virus E26 oncogene like isoform 2 (ERG) is a transcriptional regulator. It may participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ERG

Key Reference: Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: IMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHPQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcriptional regulator ERG

Protein Size: 462

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57967_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57967_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2078
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×