ERVFRD-1 Antibody - C-terminal region : FITC

ERVFRD-1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56009_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction. This gene is part of a human endogenous retrovirus provirus on chromosome 6 that has inactivating mutations in the gag and pol genes. This gene is the envelope glycoprotein gene which appears to have been selectively preserved. The gene's protein product plays a major role in placental development and trophoblast fusion. The protein has the characteristics of a typical retroviral envelope protein, including a cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ERVFRD-1

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: PLVSLLLLLLFGPCLLNLITQFVSSRLQAIKLQTNLSAGRHPRNIQESPF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: HERV-FRD_6p24.1 provirus ancestral Env polyprotein

Protein Size: 538

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56009_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56009_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 405754
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×