ETFB Antibody - C-terminal region : Biotin

ETFB Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54442_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ETFB is the electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria. This gene encodes electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria. Alternatively spliced transcript variants have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ETFB

Key Reference: Schiff,M., (2006) Mol. Genet. Metab. 88 (2), 153-158

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Electron transfer flavoprotein subunit beta

Protein Size: 255

Purification: Affinity Purified

Subunit: beta
Mehr Informationen
Artikelnummer AVIARP54442_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54442_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2109
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×