ETFB Antibody - C-terminal region : FITC

ETFB Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54441_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ETFB is the electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ETFB

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: PQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Electron transfer flavoprotein subunit beta

Protein Size: 255

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54441_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54441_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2109
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×