EXOC4 Antibody - N-terminal region : Biotin

EXOC4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56254_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC4

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: TAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Exocyst complex component 4

Protein Size: 473

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56254_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56254_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 60412
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×