EXOC6 Antibody - middle region : FITC

EXOC6 Antibody - middle region : FITC
Artikelnummer
AVIARP57320_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EXOC6

Molecular Weight: 94kDa

Peptide Sequence: Synthetic peptide located within the following region: YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Exocyst complex component 6

Protein Size: 804

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57320_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57320_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54536
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×