EXOC6 Antibody - N-terminal region : HRP

EXOC6 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57319_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC6

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cDNA FLJ46316 fis, clone TESTI4041482, highly similar to Exocyst complex component 6 EMBL BAG54647.1

Protein Size: 799

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57319_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57319_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54536
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×