EYA3 Antibody - middle region : FITC

EYA3 Antibody - middle region : FITC
Artikelnummer
AVIARP57974_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator and have a role during development. A similar protein in mice acts as a transcriptional activator.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human EYA3

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: YQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eyes absent homolog 3

Protein Size: 447

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57974_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57974_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2140
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×