FAIM Antibody - N-terminal region : FITC

FAIM Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56237_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAIM

Key Reference: Segura,M.F., (2007) J. Neurosci. 27 (42), 11228-11241

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fas apoptotic inhibitory molecule 1

Protein Size: 213

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56237_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56237_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 55179
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×