FAIM Antibody - N-terminal region : HRP

FAIM Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56237_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAIM

Key Reference: Segura,M.F., (2007) J. Neurosci. 27 (42), 11228-11241

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Fas apoptotic inhibitory molecule 1

Protein Size: 213

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56237_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56237_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 55179
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×