FAM116A Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: FAM116A belongs to the FAM116 family. The exact function of FAM116A remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM116A

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein DENND6A

Protein Size: 608

Purification: Affinity Purified

• Artikelnummer: AVIARP53536_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53536_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 201627
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin