FAM116A Antibody - middle region : HRP

FAM116A Antibody - middle region : HRP
Artikelnummer
AVIARP53536_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: FAM116A belongs to the FAM116 family. The exact function of FAM116A remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM116A

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein DENND6A

Protein Size: 608

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53536_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53536_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 201627
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×