FAM124A Antibody - middle region : FITC

FAM124A Antibody - middle region : FITC
Artikelnummer
AVIARP55453_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM124A

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: VSRVTTEASWASLPFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM124A

Protein Size: 582

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55453_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55453_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 220108
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×