FAM13C1 Antibody - N-terminal region : Biotin

FAM13C1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54376_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM13C1

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM13C

Protein Size: 487

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54376_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54376_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 220965
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×