FAM13C1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM13C1

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM13C

Protein Size: 487

Purification: Affinity Purified

• Artikelnummer: AVIARP54376_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54376_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 220965
• Wirt: Rabbit
• Konjugat: Conjugated, FITC