Fam168a Antibody - N-terminal region : FITC

Fam168a Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55188_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: NSPSYAPATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTYQASSAAFR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Family with sequence similarity 168, member A EMBL AAH79886.1

Protein Size: 235

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55188_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55188_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 319604
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×