FAM173B Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of LOC134145 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC134145

Key Reference: Lanfranchi,G., (1996) Genome Res. 6 (1), 35-42

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: EGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein FAM173B

Protein Size: 233

Purification: Affinity Purified

• Artikelnummer: AVIARP53473_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53473_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 134145
• Wirt: Rabbit
• Konjugat: Conjugated, HRP