FAM36A Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: FAM36A is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of FAM36A remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FAM36A

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome c oxidase protein 20 homolog

Protein Size: 118

Purification: Affinity Purified

• Artikelnummer: AVIARP53455_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53455_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 116228
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin