FAM36A Antibody - C-terminal region : HRP

FAM36A Antibody - C-terminal region : HRP
Artikelnummer
AVIARP53455_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: FAM36A is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of FAM36A remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FAM36A

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cytochrome c oxidase protein 20 homolog

Protein Size: 118

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53455_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53455_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 116228
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×